Protein coding transcript 120851

• Transcript: Ll_transcript_487263
• CDS coordinates: 71-874 (+)
• Peptide sequence: MLLIILLILSQDSSFNASIHKLMLPGVPWYKERLLHQTSLGSLMVIILIRTVQYNLSKLRDVYLHTTCLATLANMAPHVHRLSAYGSQRLVSLFDMLSRKYNKLADRGDDKLHIAKSNSFDENSLAEDMSTELHIYTDFLRLVLEIINAILTYALPRNPEVVYAVMHRQEVFHPFKNHPRFSELLENIYTVLDFFNSRMDAQRVDGDWSVNEVLQVIITNCRSWRGDGLKIFTQLRFTYEQETHPEEFFIPYVWQLVLSGWYGSYSL*
• ORF Type: complete

Annotations of Ll_transcript_487263

• Blastp: Dymeclin from Xenopus with 43.4% of identity
• Blastx: Dymeclin from Sophophora with 45.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (446892)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442180.1)
• Pfam: Dyggve-Melchior-Clausen syndrome protein (PF09742.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;