Protein coding transcript 1209

• Transcript: Ll_transcript_322304
• CDS coordinates: 228-1064 (+)
• Peptide sequence: MQVSEKRWFVSLLAIVGIIGASLFIVSLIQTPNNSFLCSVNYSNKNDNTPTSLQLKAILHYATSSTTPQQSFSEITITLDVLKSLKRPCNFLVFGLGLDSLMWASLNPRGRTLFLEEDASWFQKVVKDAPELNAHTVKYRTHLREADALLSSYRNEPSCSPVGAMPLRGNERCKLALHNLPDEVYDTEWDLIMVDAPKGYFAEAPGRMAAIFTAAVMGRNRKGSGVTHVFLHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPSKVNSTIYDTVFC*
• ORF Type: complete

Annotations of Ll_transcript_322304

• Blastp: Probable methyltransferase At1g27930 from Arabidopsis with 61.05% of identity
• Blastx: Probable methyltransferase At1g27930 from Arabidopsis with 61.05% of identity
• Eggnog: Pfam:DUF579(ENOG410YA8E)
• Kegg: Link to kegg annotations (AT1G27930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464703.1)
• Pfam: Polysaccharide biosynthesis (PF04669.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;