Protein coding transcript 120967

• Transcript: Ll_transcript_485942
• CDS coordinates: 1997-2305 (+)
• Peptide sequence: MNQLSSYLFIFQLVFGGEREIASGTIPDPGSLKASDITMLDVPVKVAHSILLSLARDIGTDWDIDYQLDIYLIIDLPVIGNFTIPLSQKGEFKLPTFSDIFA*
• ORF Type: complete

Annotations of Ll_transcript_485942

• Blastp: Desiccation protectant protein Lea14 homolog from Soja with 86.9% of identity
• Blastx: Desiccation protectant protein Lea14 homolog from Soja with 86.9% of identity
• Eggnog: late embryogenesis abundant protein(ENOG4111PUK)
• Kegg: Link to kegg annotations (547837)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415888.1)
• Pfam: Late embryogenesis abundant protein (PF03168.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;