Protein coding transcript 121053

• Transcript: Ll_transcript_485901
• CDS coordinates: 1-306 (+)
• Peptide sequence: DYCFWGMYGEESTKVSSLQHSIQLSSLSIQPQWLTRNLLIRRNILKSFANPKCVKPLLDYQAYVKMIQCDESGHKHFTGQYSNYWSCLDKCVAPRLLPKLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_485901

• Blastp: Cytochrome b-c1 complex subunit 6 from Solanum with 53.33% of identity
• Blastx: Cytochrome b-c1 complex subunit 6 from Solanum with 59.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016190578.1)
• Pfam: Ubiquinol-cytochrome C reductase hinge protein (PF02320.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;