Protein coding transcript 121167

• Transcript: Ll_transcript_349459
• CDS coordinates: 2-343 (+)
• Peptide sequence: SNFGWHLDVGGTPKGFVAGDQEKLLQTSLSHMKNVQPKPHSASARSCTKVHKKGIALGRSMDLTKFSNYDELIAELDQVLEFGGELTSPKKEWLIVYTDNEGDMMLVGDDPWP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_349459

• Blastp: Auxin response factor 4 from Oryza sativa with 66.67% of identity
• Blastx: Auxin response factor 2A from Lycopersicon with 62.24% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (4326957)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414721.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;