| Transcript | Ll_transcript_349460 |
|---|---|
| CDS coordinates | 2-367 (+) |
| Peptide sequence | SNFGWHLDVGGTPKGFVAGDQEKLLQTSLSHMKNVQPKPHSASARSCTKVHKKGIALGRSMDLTKFSNYDELIAELDQVLEFGGELTSPKKEWLIVYTDNEGSFVPWPAKCILTQKKRFKE* |
| ORF Type | 5prime_partial |
| Blastp | Auxin response factor 4 from Oryza sativa with 55.24% of identity |
|---|---|
| Blastx | Auxin response factor 2B from Lycopersicon with 53.06% of identity |
| Eggnog | auxin response factor(ENOG4110RNJ) |
| Kegg | Link to kegg annotations (4326957) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457943.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer