Transcript | Ll_transcript_349468 |
---|---|
CDS coordinates | 2-343 (+) |
Peptide sequence | SNFGWHLDVGGTPKGFVAGDQEKLLQTSLSHMKNVQPKPHSASARSCTKVHKKGIALGRSMDLTKFSNYDELIAELDQVLEFGGELTSPKKEWLIVYTDNEGDMMLVGDDPWP* |
ORF Type | 5prime_partial |
Blastp | Auxin response factor 4 from Oryza sativa with 66.67% of identity |
---|---|
Blastx | Auxin response factor 2A from Lycopersicon with 62.24% of identity |
Eggnog | auxin response factor(ENOG4110RNJ) |
Kegg | Link to kegg annotations (4326957) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414721.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer