Protein coding transcript 121178

• Transcript: Ll_transcript_349450
• CDS coordinates: 2-1129 (+)
• Peptide sequence: SKVSEDPLPASGYPRVLQGQELSTLRGNLVEGNKSDNVEKSVVWPPTVDDEKIDAVYTSRKYGSEGWMSMGRLETYSNLLSSYGTSIDISSHLSLLNQIGHVANPAKKHLVDREGKVNVMGSPWSVMPSSLSLNPVNSNAKGVQGGDTTYQVRRNSRHSAFAEYPLLHHGHKFEHPNGNLMMLPPPTTQYESACSKELFLKSISPNTSEVAKPKDDNCKLFGFSLLSSPTASGTSMSHRNVVNEPLRALHLPSHLHHTFENDQKSEHSRGSKPADVVVVADNQEKLLQTSHSHLKNVQSKPHSTSARSCTKVHKKGIALGRSVDLTKFSGYDELIAELDQLFEFGGELTSPKKDWLIVYTDNEGDMMLVGDDPWP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_349450

• Blastp: Auxin response factor 2B from Lycopersicon with 45.03% of identity
• Blastx: Auxin response factor 2A from Lycopersicon with 43.83% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (101249712)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457943.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;