Protein coding transcript 121275

• Transcript: Ll_transcript_350702
• CDS coordinates: 2-880 (+)
• Peptide sequence: LFFVEINAVGLRKILKKFDKRFRYRFTDYYVKTRANHPYSQLQQVFRHVGVGAVVGALSRNLHELQDRQGSYLSIYDEPTLPLQDPVIDSIRAAVDRLTHSTNFLNFLGQHALIMQEELPAPADEHVDEERYHFISLLLNLANTFLYMVNTYIIVPTADDYSMSLGAAPTVCGIVIGAMAVAQVFSSVYFSAWSNRSYFRPLVFSSIVLFLGNMMYALAYDLNSIWILLIGRLCCGFGSARAVNRRYISDCVPLKIRMQASAGFVSASALGMACGPALAGLLQIKFKLYKLTF
• ORF Type: internal

Annotations of Ll_transcript_350702

• Blastp: SPX domain-containing membrane protein At4g22990 from Arabidopsis with 84.41% of identity
• Blastx: SPX domain-containing membrane protein At4g22990 from Arabidopsis with 84.41% of identity
• Eggnog: SPX domain-containing membrane protein(ENOG41101S9)
• Kegg: Link to kegg annotations (AT4G22990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442106.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;