Transcript | Ll_transcript_350702 |
---|---|
CDS coordinates | 2-880 (+) |
Peptide sequence | LFFVEINAVGLRKILKKFDKRFRYRFTDYYVKTRANHPYSQLQQVFRHVGVGAVVGALSRNLHELQDRQGSYLSIYDEPTLPLQDPVIDSIRAAVDRLTHSTNFLNFLGQHALIMQEELPAPADEHVDEERYHFISLLLNLANTFLYMVNTYIIVPTADDYSMSLGAAPTVCGIVIGAMAVAQVFSSVYFSAWSNRSYFRPLVFSSIVLFLGNMMYALAYDLNSIWILLIGRLCCGFGSARAVNRRYISDCVPLKIRMQASAGFVSASALGMACGPALAGLLQIKFKLYKLTF |
ORF Type | internal |
Blastp | SPX domain-containing membrane protein At4g22990 from Arabidopsis with 84.41% of identity |
---|---|
Blastx | SPX domain-containing membrane protein At4g22990 from Arabidopsis with 84.41% of identity |
Eggnog | SPX domain-containing membrane protein(ENOG41101S9) |
Kegg | Link to kegg annotations (AT4G22990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442106.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer