Protein coding transcript 121297

• Transcript: Ll_transcript_351014
• CDS coordinates: 662-1120 (+)
• Peptide sequence: MDPLSQHSDQEIWEVLGKCQLREVVQEKEEGLDSSVVEAGANWSMGQRQLFCLGRALLRRSRVLVLDEATASIDNATDLILQKTIRSEFADCTVITVAHRIPTVMDCTMVLAISDGKLVEYDEPTNLMKKEGSLFGQLVKEYWSHFQSADSH*
• ORF Type: complete

Annotations of Ll_transcript_351014

• Blastp: ABC transporter C family member 10 from Arabidopsis with 86.18% of identity
• Blastx: ABC transporter C family member 10 from Arabidopsis with 84.65% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT3G59140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452765.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;