Protein coding transcript 121299

• Transcript: Ll_transcript_349116
• CDS coordinates: 165-749 (+)
• Peptide sequence: MSFSFSFHVPKALPPLPTSPHGTVSLFIASKHKPSHNNTTPSQSLHHIITCSKQKPSDYVSLKKPSLALHLGALLALIEQPALAVTGENHPPELTSVLIQLGIVLFLYFIVAPPIIMNWMRIRWYRRKFLEMYLQFMFAFIFFPGIILWAPFLNFRKFPRDPSLKYPWSVPDDPSKVRNTYSKYPYAKPEDYDP*
• ORF Type: complete

Annotations of Ll_transcript_349116

• Blastp: NAD(P)H-quinone oxidoreductase subunit L, chloroplastic from Arabidopsis with 54.21% of identity
• Blastx: NAD(P)H-quinone oxidoreductase subunit L, chloroplastic from Arabidopsis with 54.84% of identity
• Eggnog: NADH dehydrogenase transmembrane subunit(ENOG4112C5D)
• Kegg: Link to kegg annotations (AT1G70760)
• CantataDB: Link to cantataDB annotations (CNT0001331)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464128.1)
• Pfam: NADH dehydrogenase transmembrane subunit (PF10716.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;