Protein coding transcript 121328

• Transcript: Ll_transcript_350187
• CDS coordinates: 244-1044 (+)
• Peptide sequence: MSLSKLGSQTDTRLSSSDKATTLNPNAAEFVPFALRSTPSRSTGSVDPTAKFITSGSLGKAVLDRSGSSISNNSDDEAHRYWHCQLPDDITPDFKAMEEDESQGLNNLSLAGLSIHDDDESSRFPSMGSRFILSEKQHLNENNIAADKFRFSNSNYRVEPSSASLLSPLAKPWDRQIGNANQHVIGGREGLIYDDNSKHGFLNDILSDNVIVDDTSANPLEFLASLFPGFASESLAEVYFANGCDLHLTIDMLTQLEGRAGAIIKL*
• ORF Type: complete

Annotations of Ll_transcript_350187

• Blastp: Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 50.19% of identity
• Blastx: Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 62.28% of identity
• Eggnog: smr domain containing protein(ENOG4111EZQ)
• Kegg: Link to kegg annotations (AT2G26280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436179.1)
• Pfam: Ataxin-2 C-terminal region (PF07145.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;