Transcript | Ll_transcript_350179 |
---|---|
CDS coordinates | 244-1041 (+) |
Peptide sequence | MSLSKLGSQTDTRLSSSDKATTLNPNAAEFVPFALRSTPSRSTGSVDPTAKFITSGSLGKAVLDRSGSSISNNSDDEAHRYWHCQLPDDITPDFKAMEEDESQGLNNLSLAGLSIHDDDESSRFPSMGSRFILSEKQHLNENNIAADKFRFSNSNYRVEPSSASLLSPLAKPWDRQIGNANQHVIGGREGLIYDDNSKHGFLNDILSDNVIVDDTSANPLEFLASLFPGFASESLAEVYFANGCDLHLTIDMLTQLEVSRSSLSN* |
ORF Type | complete |
Blastp | Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 50% of identity |
---|---|
Blastx | Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 62.28% of identity |
Eggnog | smr domain containing protein(ENOG4111EZQ) |
Kegg | Link to kegg annotations (AT2G26280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436179.1) |
Pfam | Ataxin-2 C-terminal region (PF07145.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer