Protein coding transcript 121442

• Transcript: Ll_transcript_348920
• CDS coordinates: 47-373 (+)
• Peptide sequence: MTMRVVPASFSVINSNDSSLGFVRSSDFVRLSDLKKRTQYVRTKVSVIRNSKPGQDNIVELQPASQGIPLLVPRQKYCESLHKTVRRKTRTVMVGNVAIGSEHPIRIQT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_348920

• Blastp: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Arabidopsis with 65.14% of identity
• Blastx: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Arabidopsis with 65.14% of identity
• Eggnog: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity(COG0821)
• Kegg: Link to kegg annotations (AT5G60600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448725.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;