Protein coding transcript 121479

• Transcript: Ll_transcript_348556
• CDS coordinates: 292-633 (+)
• Peptide sequence: MKGSKSKPVSSVSASQNLWLSSNLSKRWGEIFFLLYTPFWLTLCLGIVIPFNLYEKFTELEYLLIGLISAVPSVLIPILFAGKADRDIPWKDRYWVKASVFMDIIFRIFDITV*
• ORF Type: complete

Annotations of Ll_transcript_348556

• Blastp: Cycloeucalenol cycloisomerase from Arabidopsis with 68.48% of identity
• Blastx: Cycloeucalenol cycloisomerase from Arabidopsis with 69.77% of identity
• Eggnog: Cycloeucalenol(ENOG410YNGH)
• Kegg: Link to kegg annotations (AT5G50375)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415501.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;