Protein coding transcript 121481

• Transcript: Ll_transcript_348567
• CDS coordinates: 1-939 (+)
• Peptide sequence: AFSFSNLIIAYYFFVFWKSQGSKSKPVSSVSASQNLWLSSNLSKRWGEIFFLLYTPFWLTLCLGIVIPFNLYEKFTELEYLLIGLISAVPSVLIPILFAGKADRDIPWKDRYWVKASLWIMIFSYVGNYFWTHYFFTVLGASYTFPSWRMNNVPHTTFLLAHVCFLFYHVASNMTLRRLRHFVADMPEKVQWAAEAAWILALSYFIAYLETLAISSFPYYEFVDRDSMYKVGSLFYAIYFIVSFPMFIRIEEKPRDKWDLARVAIDALGAAMLVTILLDLWRIFLGPIVPISDVKQCPQAGLAWFPGHTNQT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_348567

• Blastp: Cycloeucalenol cycloisomerase from Arabidopsis with 75.45% of identity
• Blastx: Cycloeucalenol cycloisomerase from Arabidopsis with 76.01% of identity
• Eggnog: Cycloeucalenol(ENOG410YNGH)
• Kegg: Link to kegg annotations (AT5G50375)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415501.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;