| Transcript | Ll_transcript_348765 |
|---|---|
| CDS coordinates | 2-349 (+) |
| Peptide sequence | SLVNPAGKDLYIALYASWCHSPMAIISLCFIAQTYQHASVVIQSLLEEDINPKFLVQLDKLIRLLETPIFAYLRLQLLEPGRYIWLFKALYGLLMLLPQVSETLTISFLQKLARL* |
| ORF Type | 5prime_partial |
| Blastp | Protein VAC14 homolog from Arabidopsis with 38.18% of identity |
|---|---|
| Blastx | Protein VAC14 homolog from Arabidopsis with 81.13% of identity |
| Eggnog | vac14 homolog (S. cerevisiae)(ENOG410XP6E) |
| Kegg | Link to kegg annotations (AT2G01690) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461623.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer