Protein coding transcript 121504

• Transcript: Ll_transcript_348778
• CDS coordinates: 1051-1359 (+)
• Peptide sequence: MNVLNPFVRQFLVGWISVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAGSPDEFTRLTAVTWINEFVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_348778

• Blastp: Protein VAC14 homolog from Arabidopsis with 96.12% of identity
• Blastx: Protein VAC14 homolog from Arabidopsis with 79.43% of identity
• Eggnog: vac14 homolog (S. cerevisiae)(ENOG410XP6E)
• Kegg: Link to kegg annotations (AT2G01690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432673.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;