Transcript | Ll_transcript_348784 |
---|---|
CDS coordinates | 239-568 (+) |
Peptide sequence | MADALSVVPAAVLRNLADKLYERRKNAALEVEGIVKQLAVNGEHDKISAVINLLATEYTYSPQANHRKGGLIGLAAATVGLTTEAAQHLEKLGQTTTSKKLYKNEVASI* |
ORF Type | complete |
Blastp | Protein VAC14 homolog from Arabidopsis with 71.74% of identity |
---|---|
Blastx | Protein VAC14 homolog from Arabidopsis with 71.74% of identity |
Eggnog | vac14 homolog (S. cerevisiae)(ENOG410XP6E) |
Kegg | Link to kegg annotations (AT2G01690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420394.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer