Protein coding transcript 121521

• Transcript: Ll_transcript_348775
• CDS coordinates: 199-1131 (+)
• Peptide sequence: MADALSVVPAAVLRNLADKLYEKRKNAALEVEGIVKQLAANGEHDKITAVINLLTTEFTYSPQANHRKGGLIGLAAATVGLTTDAAQHLEEIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDVLCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAGSSDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_348775

• Blastp: Protein VAC14 homolog from Arabidopsis with 89.71% of identity
• Blastx: Protein VAC14 homolog from Arabidopsis with 89.71% of identity
• Eggnog: vac14 homolog (S. cerevisiae)(ENOG410XP6E)
• Kegg: Link to kegg annotations (AT2G01690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420378.1)
• Pfam: Vacuolar 14 Fab1-binding region (PF12755.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;