Transcript | Ll_transcript_348516 |
---|---|
CDS coordinates | 252-827 (+) |
Peptide sequence | MNLDQKPMDTVRGAIKQAETMADNFWNHMRISHNVAGTAMGRIVQGTKVLAHGGTEKLFQQIFGNFPAEKLLNSYTCYISTSSGPVLGTLYVSTIRLAFCSDNPLSHNTLAMQNRGNHYKVVVPLDQVSMVTPSSNRLNPKEKYIELVTVDGYEFFFMGLLAYENALKTIKEALPQYHKYYRGNLSVQVLL* |
ORF Type | complete |
Blastp | GLABRA2 expression modulator from Arabidopsis with 47.75% of identity |
---|---|
Blastx | GLABRA2 expression modulator from Arabidopsis with 47.75% of identity |
Eggnog | GRAM(ENOG410YEXI) |
Kegg | Link to kegg annotations (AT2G22475) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451394.1) |
Pfam | GRAM domain (PF02893.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer