| Transcript | Ll_transcript_348527 |
|---|---|
| CDS coordinates | 2-484 (+) |
| Peptide sequence | YFASITVKVSWFFLPLNKTMNDHREIPVRSSYTGISNYGSNNNNPYVQISLVPTSPEAKNHQKPMDTVRGAIKQAETMADNFWNHMRISHNVAGTAMGRIVQGTKVLAHGGTEKLFQQIFGNFPAEKLLNSYTCYISTSSGPVLGTLYISTSSGPVLGTLY |
| ORF Type | internal |
| Blastp | GEM-like protein 1 from Arabidopsis with 45.45% of identity |
|---|---|
| Blastx | GEM-like protein 1 from Arabidopsis with 45.45% of identity |
| Eggnog | GEM-like protein(ENOG410YBXM) |
| Kegg | Link to kegg annotations (AT1G28200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451394.1) |
| Pfam | GRAM domain (PF02893.19) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer