Protein coding transcript 121583

• Transcript: Ll_transcript_350462
• CDS coordinates: 232-729 (+)
• Peptide sequence: MAASDVQNNGSTIRNAFGNVLAFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQYLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWVLNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGLTAAVLLAMVNFSAGFVT*
• ORF Type: complete

Annotations of Ll_transcript_350462

• Blastp: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A from Oryza sativa with 83.87% of identity
• Blastx: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A from Arabidopsis with 85.42% of identity
• Eggnog: oligosaccharyl transferase STT3 subunit(COG1287)
• Kegg: Link to kegg annotations (4339345)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448366.1)
• Pfam: Oligosaccharyl transferase STT3 subunit (PF02516.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;