Protein coding transcript 121664

• Transcript: Ll_transcript_349688
• CDS coordinates: 3-752 (+)
• Peptide sequence: GGEVNISAGGATPLHIAADNGSLELINCLLKGGTDPNISDEDGIKPLQVAAARGNRAAVEILFPLTSKIDAVSTWTIDGIVEYMQSETKRQPDETINIREANRSKGVSQEKKVPEVAPEVKKRAAEAKSRGDDAFKRKDYTTAIDSYTQAIDLDPTDATLLSNRSLCWMKLGQAEHALADAKACRELRPDWVKACYREGAALRVLQKFDEAANAFYEGVQLDPENMELVNAFREAVEAGRKFHGITENK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_349688

• Blastp: Hsp70-Hsp90 organizing protein 3 from Arabidopsis with 47.32% of identity
• Blastx: Hsp70-Hsp90 organizing protein 3 from Arabidopsis with 47.32% of identity
• Eggnog: tetratricopeptide repeat domain(ENOG410XTCJ)
• Kegg: Link to kegg annotations (AT4G12400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419973.1)
• Pfam: Ankyrin repeats (many copies) (PF13857.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;