Protein coding transcript 121667

• Transcript: Ll_transcript_349701
• CDS coordinates: 3-308 (+)
• Peptide sequence: GGEVNISAGGATPLHIAADNGSLELINCLLKGGTDPNISDEDGIKPLQVAAARGNRAAVEILFPLTSKIDAVSTWTIDGIVEYMQSETKRQPVPKLTANVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_349701

• Blastp: Ankyrin repeat and SOCS box protein 2 from Bos with 37.68% of identity
• Blastx: Ankyrin repeat and SOCS box protein 2 from Bos with 37.68% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (539244)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419974.1)
• Pfam: Ankyrin repeats (many copies) (PF13857.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;