Protein coding transcript 121668

• Transcript: Ll_transcript_349702
• CDS coordinates: 3-656 (+)
• Peptide sequence: GGEVNISAGGATPLHIAADNGSLELINCLLKGGTDPNISDEDGIKPLQVAAARGNRAAVEILFPLTSKIDAVSTWTIDGIVEYMQSETKRQPDETINIREANRSKGVSQEKKVPEVAPEVKKRAAEAKSRGDDAFKRKDYTTAIDSYTQAIDLDPTDATLLSNRSLCWMKLGQAEHALADAKACRELRPDWVKACYREGAALHVLQVCFSKTICLLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_349702

• Blastp: Heat shock protein sti1 homolog from Schizosaccharomyces with 52.44% of identity
• Blastx: Heat shock protein sti1 homolog from Schizosaccharomyces with 52.44% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC645.14c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419974.1)
• Pfam: Ankyrin repeats (many copies) (PF13857.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;