Transcript | Ll_transcript_350869 |
---|---|
CDS coordinates | 293-691 (+) |
Peptide sequence | MGSRGLFGWSPPHIQPLTPVSEVSEPPESPSPYLDPSAETSASQQVEVEEEVEEPEEIEPPPAAVAFSQLFACADRFDWFLMIVGSVAAAAHGTALVVYLHYFAKIVHVLRMDSQEGSSEEQFKRFSEGMQA* |
ORF Type | complete |
Blastp | ABC transporter B family member 20 from Arabidopsis with 68.15% of identity |
---|---|
Blastx | ABC transporter B family member 6 from Arabidopsis with 74.63% of identity |
Eggnog | (ABC) transporter(COG1132) |
Kegg | Link to kegg annotations (AT3G55320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455348.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer