Protein coding transcript 121696

• Transcript: Ll_transcript_350870
• CDS coordinates: 1324-2112 (+)
• Peptide sequence: MHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLNKILTQSFFHGVAIGFGFGFSQFLLFACNALLLWYTALCIKNRYVSPTTALKEYMVFSFAAFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDNSALKPPNVYGRIELKNVDFCYPSRPEMLVLSNFTLKVSRGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRSHLGLVQQEPIIFSTTIRENIIYARHNASEAEMKEAARIAN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_350870

• Blastp: ABC transporter B family member 6 from Arabidopsis with 87.83% of identity
• Blastx: ABC transporter B family member 6 from Arabidopsis with 87.81% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT2G39480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427684.1)
• Pfam: ABC transporter transmembrane region (PF00664.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;