Protein coding transcript 121710

• Transcript: Ll_transcript_350862
• CDS coordinates: 318-716 (+)
• Peptide sequence: MGSRGLFGWSPPHIQPLTPVSEVSEPPESPSPYLDPSAETSASQQVEVEEEVEEPEEIEPPPAAVAFSQLFACADRFDWFLMIVGSVAAAAHGTALVVYLHYFAKIVHVLRMDSQEGSSEEQFKRFSEGMQA*
• ORF Type: complete

Annotations of Ll_transcript_350862

• Blastp: ABC transporter B family member 20 from Arabidopsis with 68.15% of identity
• Blastx: ABC transporter B family member 6 from Arabidopsis with 74.63% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT3G55320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455348.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;