Protein coding transcript 121713

• Transcript: Ll_transcript_350866
• CDS coordinates: 209-613 (+)
• Peptide sequence: MSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFISGLVIGLVNCWQIALITLATGPFIVASGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIKTLYAFTNETLAKYSYATSLQATLRYGILISL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_350866

• Blastp: ABC transporter B family member 6 from Arabidopsis with 95.56% of identity
• Blastx: ABC transporter B family member 20 from Arabidopsis with 95.73% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT2G39480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455348.1)
• Pfam: ABC transporter transmembrane region (PF00664.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;