Protein coding transcript 121878

• Transcript: Ll_transcript_349350
• CDS coordinates: 361-813 (+)
• Peptide sequence: MGIFLMKWQWPWLLFVLLIYIVINTSKAINPDGEVLVSFRTTVVSSDGVLVQWRPEDPDPCKWKGVKCDPKTKRVTHLSLPHHKLSGSLSPDLGKLEHLRVLALHDNNLYGTIPSALGNCTDLQGIFLQGNYFSGTIPGEIGNLSQLQNL*
• ORF Type: complete

Annotations of Ll_transcript_349350

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 61.38% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 60.56% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G35620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421715.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;