Protein coding transcript 121899

• Transcript: Ll_transcript_349344
• CDS coordinates: 1357-2010 (+)
• Peptide sequence: MIPGEIGKLSQLQNLDISSNSLSGTIPASLGNLYSLKNFNVSANFLDGTIPSDGVLANFTASSFAGNRGLCGVQISSTCDGSPDANSPSNSDQNENGRKKYSGRLLISASATVGALLLVALMCFWGCFLYKKFGKNDRGSLAMGVSSGASIVVFHGDLPYSSKEIIKKLETLNEEHIIGIGGFGTVYKLAMEDGNVFALKRIVKLNEGFDRFFERELE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_349344

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 70.97% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 68.73% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G31420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445201.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;