Protein coding transcript 121906

• Transcript: Ll_transcript_348705
• CDS coordinates: 1-354 (+)
• Peptide sequence: VVDIRVPMTKYMVGIQKGIVEVMDACLKEMRKTNKVDVEDLTVENGLFKSFDEIVKRQLDPIWHTLGKKTKQLVSDLRTLRKLLDYLVRYLVSFLLLLFWFGHFGVYLGTVLCHYGS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_348705

• Blastp: DNA repair endonuclease UVH1 from Arabidopsis with 84.85% of identity
• Blastx: DNA repair endonuclease UVH1 from Arabidopsis with 87.06% of identity
• Eggnog: Excision repair cross-complementing rodent repair deficiency, complementation group 4(COG1948)
• Kegg: Link to kegg annotations (AT5G41150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421214.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;