Protein coding transcript 121975

• Transcript: Ll_transcript_351168
• CDS coordinates: 364-738 (+)
• Peptide sequence: MIFSRIGRSLSRSSRARNLLQGDGVSYSFVGEGGLGFLRGYIAPASNGFNSNLSDFKSIGANPRLLRLFSSEAPEKKNYDNFSPKEKKEVPKGDDSKQESKDDSNTKTDDSKQESKDDSNTKTDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_351168

• Blastp: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial from Arabidopsis with 39.67% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial from Arabidopsis with 47.76% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT1G07510)
• CantataDB: Link to cantataDB annotations (CNT0000340)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413392.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;