Protein coding transcript 12199

• Transcript: Ll_transcript_411243
• CDS coordinates: 160-837 (+)
• Peptide sequence: MLQNDDIRFISSSIKIPIPPKSPTFTSHFTNATKTVTQLIDSFKTHSNEFTRSVFGKPSLMCSTTLSLIKPFRKRSSPILCSASLSLSESTQSQGTRQNEERVLISEVLVRNKEGEELERKDLEAEALQALKACRPNSALTVSEVQDDVHRIINSGYFCSCMPVAVDTRDGIRLVFQVEPNQEFQGLVCEGANVLPAKYLEDSFRDGYGNTFLFSYSCNYNCFHA*
• ORF Type: complete

Annotations of Ll_transcript_411243

• Blastp: Outer envelope protein 80, chloroplastic from Arabidopsis with 52.08% of identity
• Blastx: Outer envelope protein 80, chloroplastic from Arabidopsis with 65.33% of identity
• Eggnog: Gram-negative-bacterium-type cell outer membrane assembly(COG4775)
• Kegg: Link to kegg annotations (AT5G19620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458659.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;