Protein coding transcript 122104

• Transcript: Ll_transcript_349064
• CDS coordinates: 522-1049 (+)
• Peptide sequence: MDISNNLFSSSLPSGIGNLGSLKNLSLAGNSFSGLIPDTISKMDSIQSLDLSCNSFSGALPASLTKLKSLLSLNLSHNRFTGNIPKGFELMSSLEKLDLHGNMLGGHLDAEFILLSSASYVDFSDNGLDSSDSERQKFLPRISESIKHLNLSHNLLTGTLVSGAEQPVFENLKVLD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_349064

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 61.36% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 68.33% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G20940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440111.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;