Protein coding transcript 122125

• Transcript: Ll_transcript_349293
• CDS coordinates: 114-902 (+)
• Peptide sequence: MYMKVKSPVPYRLRKLMPQHLKYGINFAVGGTGVFDTLTGGPNMTTQIDLFEQVIKDKVYTASDFNTSVALVSIAGNDYSHYLATNGSTQGLPSFVASVINQTTTNLIRIKGLGVKKIVVGGLQPLGCLPQMTATFSFQQCNNTTNDLVLLHNNLLTQVVTTLNQQTNDHSSFIVLNLYDSFMSVLNHPSTHHIQNQLKPCCVGVSSESFCGSVDEKNVKKYKVCDDPKSAFFWDLVHPTQAGWHAVYNKLRTMNVLQQIYY*
• ORF Type: complete

Annotations of Ll_transcript_349293

• Blastp: GDSL esterase/lipase At5g03610 from Arabidopsis with 53.7% of identity
• Blastx: GDSL esterase/lipase At5g03610 from Arabidopsis with 52.88% of identity
• Eggnog: GDSL esterase lipase(ENOG4111T31)
• Kegg: Link to kegg annotations (AT5G03610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455740.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;