Transcript | Ll_transcript_349294 |
---|---|
CDS coordinates | 1642-2166 (+) |
Peptide sequence | MQGLPSFVASVINQTTTNLIRIKGLGVKKIVVGGLQPLGCLPQMTATFSFQQCNNTTNDLVLLHNNLLTQVVTTLNQQTNDHSSFIVLNLYDSFMSVLNHPSTHHIQNQLKPCCVGVSSESFCGSVDEKNVKKYKVCDDPKSAFFWDLVHPTQAGWHAVYNKLRTMNVLQQIYY* |
ORF Type | complete |
Blastp | GDSL esterase/lipase At5g03610 from Arabidopsis with 57.58% of identity |
---|---|
Blastx | GDSL esterase/lipase At5g03610 from Arabidopsis with 57.58% of identity |
Eggnog | GDSL esterase lipase(ENOG4111T31) |
Kegg | Link to kegg annotations (AT5G03610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455740.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer