Protein coding transcript 122134

• Transcript: Ll_transcript_349327
• CDS coordinates: 264-668 (+)
• Peptide sequence: MLLQIENEYGAQSKLLGAAGENYVKWAAKMAVELGTGVPWVMCKEDDAPDPVVSNSTFPLENCGKGISCPQICLQPCIKPIRSKHECLIILTNVTRCYPFGTGFGTTDLCPKLCTVKHLFHLLFCYFENRVFTR*
• ORF Type: complete

Annotations of Ll_transcript_349327

• Blastp: Beta-galactosidase 3 from Arabidopsis with 72.22% of identity
• Blastx: Beta-galactosidase 5 from Oryza sativa with 94.64% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT4G36360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446869.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;