Transcript | Ll_transcript_349329 |
---|---|
CDS coordinates | 490-834 (+) |
Peptide sequence | MSWATALVRISPYTFSAIGIAVSIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIRLCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPTKV* |
ORF Type | complete |
Blastp | V-type proton ATPase subunit c''2 from Arabidopsis with 56.8% of identity |
---|---|
Blastx | V-type proton ATPase subunit c''2 from Arabidopsis with 56.73% of identity |
Eggnog | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity)(COG0636) |
Kegg | Link to kegg annotations (AT2G25610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016196972.1) |
Pfam | ATP synthase subunit C (PF00137.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer