Protein coding transcript 122172

• Transcript: Ll_transcript_350336
• CDS coordinates: 1221-1631 (+)
• Peptide sequence: MSGSRMKIAGRFKPCVHMGCFDLDVFVEMNQRSRKWQCPICLKNYALENIIVDPYFNRITSKMMRCGEEVTEVEVKLDGSWRVKVKSESERLELGNLAQWHSPDGSVCVSNDGEVKRLETLKQVKHEASDTPAGLKI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_350336

• Blastp: E3 SUMO-protein ligase SIZ1 from Arabidopsis with 70.8% of identity
• Blastx: E3 SUMO-protein ligase SIZ1 from Arabidopsis with 71.2% of identity
• Eggnog: Protein inhibitor of activated STAT(ENOG410XQ2E)
• Kegg: Link to kegg annotations (AT5G60410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453986.1)
• Pfam: MIZ/SP-RING zinc finger (PF02891.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;