Transcript | Ll_transcript_350343 |
---|---|
CDS coordinates | 1147-1557 (+) |
Peptide sequence | MSGSRMKIAGRFKPCVHMGCFDLDVFVEMNQRSRKWQCPICLKNYALENIIVDPYFNRITSKMMRCGEEVTEVEVKLDGSWRVKVKSESERLELGNLAQWHSPDGSVCVSNDGEVKRLETLKQVKHEASDTPAGLKI |
ORF Type | 3prime_partial |
Blastp | E3 SUMO-protein ligase SIZ1 from Arabidopsis with 70.8% of identity |
---|---|
Blastx | E3 SUMO-protein ligase SIZ1 from Arabidopsis with 71.43% of identity |
Eggnog | Protein inhibitor of activated STAT(ENOG410XQ2E) |
Kegg | Link to kegg annotations (AT5G60410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453986.1) |
Pfam | MIZ/SP-RING zinc finger (PF02891.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer