Protein coding transcript 122181

• Transcript: Ll_transcript_350351
• CDS coordinates: 581-1120 (+)
• Peptide sequence: MQWPQHTDLQVNGVPVRAINRPGSQLLGANGRDDGPIITPYIKDGINKIHLTGCDARVFCFGIRIVKRRNMQQVLNIIPKEADGERFEDALARVCRCVGGGNADDNADSDSDLEVVSDTFTINLRCPMSGSRMKIAGRFKPCVHMGCFDLEVFVEMNQRSRKWQCPICLKKLCFGEYHR*
• ORF Type: complete

Annotations of Ll_transcript_350351

• Blastp: E3 SUMO-protein ligase SIZ1 from Arabidopsis with 56.08% of identity
• Blastx: E3 SUMO-protein ligase SIZ1 from Arabidopsis with 56.72% of identity
• Eggnog: Protein inhibitor of activated STAT(ENOG410XQ2E)
• Kegg: Link to kegg annotations (AT5G60410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448718.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;