Transcript | Ll_transcript_350354 |
---|---|
CDS coordinates | 581-1120 (+) |
Peptide sequence | MQWPQHTDLQVNGVPVRAINRPGSQLLGANGRDDGPIITPYIKDGINKIHLTGCDARVFCFGIRIVKRRNMQQVLNIIPKEADGERFEDALARVCRCVGGGNADDNADSDSDLEVVSDTFTINLRCPMSGSRMKIAGRFKPCVHMGCFDLEVFVEMNQRSRKWQCPICLKKLCFGEYHR* |
ORF Type | complete |
Blastp | E3 SUMO-protein ligase SIZ1 from Arabidopsis with 54.09% of identity |
---|---|
Blastx | E3 SUMO-protein ligase SIZ1 from Arabidopsis with 54.88% of identity |
Eggnog | Protein inhibitor of activated STAT(ENOG410XQ2E) |
Kegg | Link to kegg annotations (AT5G60410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448718.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer