Transcript | Ll_transcript_350900 |
---|---|
CDS coordinates | 229-1149 (+) |
Peptide sequence | MEWTTLQHLDLRHVGRSGKSLQPHAASFHPHQALVAVAIGTYIVEFDALTGSKISALDIGAPVVRMSYSPTSGHTVIAILQDCTLRSCDFDSEQTCVLHSPEKKSDQVSSDAEVHLALTPLQTVAFFGFHKRMSVTVVGTVEGGRAPTKIKTDLKKPIVNLACHPRLPVLYVAYADGLIRAYNIHTYAVHYTLQLDNTIKLNGAGAFAFHPTLEWIFVGDRRGTLLAWDVSTERPSMIGITQVGSQPIASVAWLPILRLLVTLSRDGNLQVWKTRVIANPNRPVLANFFESAGSFCFYSKFSVGFG* |
ORF Type | complete |
Blastp | COMPASS component SWD1 from Saccharomyces with 31.82% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (YAR003W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421477.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer