Transcript | Ll_transcript_350934 |
---|---|
CDS coordinates | 3-308 (+) |
Peptide sequence | CSLSPHLFPLASYRHLSQLILSCCISSSALILSPRDNMIEGVALTLLEAGQSKLRSRLEEEEQDKAALMERTQRLTKPISVSTKNSISSTSTIPERPGHRF* |
ORF Type | 5prime_partial |
Blastp | Kinesin-like protein KIN-7E, chloroplastic from Oryza sativa with 74% of identity |
---|---|
Blastx | - |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (9271714) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456134.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer