Transcript | Ll_transcript_495711 |
---|---|
CDS coordinates | 177-839 (+) |
Peptide sequence | MQSTEALSAMEVEAVASEPKLLPPKPEFAPLKPHEMSDGQVQFRKVSVPPHRYTPLKKAWMDIYTPVYEQMKIDIRMNLKARKVELKTRHDTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEVKDVKTLRGDHLSRAIGRLSGKGGKTKFAIENATKTRVVIADSKIHILGSFANIKIARDSLCSLIMGSPAGKVYSKLRAVTARLAERF* |
ORF Type | complete |
Blastp | RNA-binding protein pno1 from Sophophora with 60% of identity |
---|---|
Blastx | RNA-binding protein pno1 from Sophophora with 58.67% of identity |
Eggnog | Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity)(COG1094) |
Kegg | Link to kegg annotations (Dmel_CG11738) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447032.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer