Protein coding transcript 122362

• Transcript: Ll_transcript_350769
• CDS coordinates: 599-901 (+)
• Peptide sequence: MIIFHEYPMSMVDRVLFKEFCGALQSLFKGISRNTVKGDITRMYNEEKVNIMTLISKNQSRFAITTDMWITSNQNKGYMAVTAHFIDDSWILQSRLMSTP*
• ORF Type: complete

Annotations of Ll_transcript_350769

• Blastp: Putative AC9 transposase from Zea with 46.39% of identity
• Blastx: Putative AC transposase from Zea with 38.05% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427131.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;