Protein coding transcript 122363

• Transcript: Ll_transcript_350770
• CDS coordinates: 94-666 (+)
• Peptide sequence: MSTEQASVGQDQVPNASNVGESNSVPINVDVPSIQDETHCSSPNDAEEGQPQQRSSVWNHFKRQKVDGKWKAACNYCGKRLLGDPSQGTKHLHNHFKSCLRHSNSDIKQALLKTAKKGNESVLVGSYAFNQEAARHALVKMIIFHEYPMSMVDRVLFKEFCGALQSLFKGISRNTVKGDITRMYNEEKVNI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_350770

• Blastp: Zinc finger BED domain-containing protein RICESLEEPER 3 from Oryza sativa with 30% of identity
• Blastx: Zinc finger BED domain-containing protein RICESLEEPER 3 from Oryza sativa with 30% of identity
• Eggnog: transposon protein(ENOG410Y37V)
• Kegg: Link to kegg annotations (4339741)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427131.1)
• Pfam: BED zinc finger (PF02892.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;