Protein coding transcript 122367

• Transcript: Ll_transcript_350776
• CDS coordinates: 850-1416 (+)
• Peptide sequence: MSTEQASVGQDQVPNASNVGESNSVPINVDVPSIQDETHCSSPNDAEEGQPQQRSSVWNHFKRQKVDEKWKAACNYCGKRLLGDPSQGTKHLHNHFKSCLRRSNSYIKQALLKTAKKGNESVLVGSYAFNQEAARRALAKMIIFHEYPMSMVDHVLFKEFCGALQPLLKGIYRNAVNGDITRCIMKRK*
• ORF Type: complete

Annotations of Ll_transcript_350776

• Blastp: Zinc finger BED domain-containing protein DAYSLEEPER from Arabidopsis with 26.37% of identity
• Blastx: Putative AC transposase from Zea with 31.2% of identity
• Eggnog: zinc finger(ENOG41115TD)
• Kegg: Link to kegg annotations (AT3G42170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427131.1)
• Pfam: BED zinc finger (PF02892.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;