Transcript | Ll_transcript_350776 |
---|---|
CDS coordinates | 850-1416 (+) |
Peptide sequence | MSTEQASVGQDQVPNASNVGESNSVPINVDVPSIQDETHCSSPNDAEEGQPQQRSSVWNHFKRQKVDEKWKAACNYCGKRLLGDPSQGTKHLHNHFKSCLRRSNSYIKQALLKTAKKGNESVLVGSYAFNQEAARRALAKMIIFHEYPMSMVDHVLFKEFCGALQPLLKGIYRNAVNGDITRCIMKRK* |
ORF Type | complete |
Blastp | Zinc finger BED domain-containing protein DAYSLEEPER from Arabidopsis with 26.37% of identity |
---|---|
Blastx | Putative AC transposase from Zea with 31.2% of identity |
Eggnog | zinc finger(ENOG41115TD) |
Kegg | Link to kegg annotations (AT3G42170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427131.1) |
Pfam | BED zinc finger (PF02892.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer